Scaffold Ga0212088_10437394

Overview

Basic Information

• Taxon OID: 3300022555
• Scaffold ID: Ga0212088_10437394
• Source Dataset Name: Alinen_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 868
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Finland: Lake Alinen Mustajarvi
• Coordinates
  • Lat. (^o): 61.5637
  • Long. (^o): 22.044
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007590	Metagenome / Metatranscriptome	348	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212088_104373941	F007590	GGA	MIALFLSLLAGCGGKPGRMEQAEDPQGRYRDQIVAAKRLLEQEEQWADRADWEVVKSADGWQVTAWRVEHPERKGSSRYLPWGYSVIEMDSRMVPHGYRRGG