Scaffold Ga0212089_10307144

Overview

Basic Information

• Taxon OID: 3300022551
• Scaffold ID: Ga0212089_10307144
• Source Dataset Name: Boni_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 743
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Indonesia: Gulf of Boni
• Coordinates
  • Lat. (^o): -2.75
  • Long. (^o): 121.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086591	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212089_103071442	F086591	GAG	LKKRLAKRCIPSSMKWKLVLKGIGKLYRAIYDELEKDDGSASGKALADAAYRVGLDFGETLKETFQLGNTIEDIAFAMDVDHKVFGVDAVVAEKSDRRIVYHCYKCAWKKYFTSRLCIAIGQAEKGVAHALNSGAKYNILQTRTMGKE