Scaffold Ga0212091_10204879

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212091_10204879

Scaffold Ga0212091_10204879

Overview

Basic Information
Taxon OID	3300022549 Open in IMG/M
Scaffold ID	Ga0212091_10204879 Open in IMG/M
Source Dataset Name	Cold Creek_combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	794
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Cold Creek Source, Nevada
Coordinates	Lat. (^o)	36.41	Long. (^o)	-115.74	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063797	Metagenome / Metatranscriptome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212091_102048791	F063797	AGGAGG	MSRIGIAVTLIFFVGFAQAQAPGMAPPLPIGASTDADVRDKKLDPAAVEIPLYAGARVMDVLQSLTDKGFAIKWDKSQIGPSMKLLEKPKATRIDSLLSEILTPWGFRADHNLRDGGYRVRPLKNPKKKPGE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.