Scaffold Ga0212092_1001344

Overview

Basic Information

• Taxon OID: 3300022548
• Scaffold ID: Ga0212092_1001344
• Source Dataset Name: Cone Pool_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 27557
• Total Scaffold Genes: 30
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 17 (56.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.4127
  • Long. (^o): -118.504

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024422	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212092_100134411	F024422	N/A	MLLDFKRGAFPAWELEPEDGIPVPCVQNQPWVNEDTLATLARLRIPRTDPWGRPLPGEPDDPVLPLFRAKRR