Scaffold Ga0242660_1145516

Overview

Basic Information

• Taxon OID: 3300022531
• Scaffold ID: Ga0242660_1145516
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 617
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location

• Location Name: USA: Massachusetts
• Coordinates
  • Lat. (^o): 42.481016
  • Long. (^o): -72.178343

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020888	Metagenome / Metatranscriptome	221	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0242660_11455162	F020888	N/A	QNVLDALPSAFAQLVFLSSLRDPYTGRYLHEGWASVSTPEEVNAALRETHRSVFEAVVSLSLMDLSRELRKHFNSLGQVEVRVANLWLETEPYYEMIPAGCSLLARRFFISQFRSALEVLIQAPGWTYLEEPASSQLPPPDPGPRPRWLN