NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224534_1014730

Scaffold Ga0224534_1014730


Overview

Basic Information
Taxon OID3300022524 Open in IMG/M
Scaffold IDGa0224534_1014730 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2254
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0469Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004753Metagenome / Metatranscriptome425Y
F010341Metagenome / Metatranscriptome305Y
F012089Metagenome / Metatranscriptome284Y

Sequences

Protein IDFamilyRBSSequence
Ga0224534_10147301F012089N/APVEVWISDLYEKDGRLLVRYTVCNHGTEPYSIDTPLVYQLDGVRSPQSLYGLQNSQLGDEQAAKLKIKQETPVKVLDGQIQTVRIAPGEEAVGVVALEMASSAQPTVLRFQFPRSKQSEDGLSNGPQTQIAAFLVR
Ga0224534_10147302F010341AGGTGGMADPFTVKPVYNALSQYIRNRADIGASRAMRDGVLEPSNPFERKAARPPRRWFVLLSLVFALMFGCFSYFNNLL
Ga0224534_10147303F004753N/AMDMNDQDDANEVRPLTQSEVNSDARDQIRDWEFLFWAFLLFGLARLAWLYLYRPPNSAFHLGFSCGFVFCGVLGFLMRRVFSPKRGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.