Scaffold Ga0224534_1000235

Overview

Basic Information

• Taxon OID: 3300022524
• Scaffold ID: Ga0224534_1000235
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 37128
• Total Scaffold Genes: 35
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 16 (45.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0469
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080787	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224534_10002354	F080787	AGG	MNAIATREKRLFEMTLKAAVIYDDFDFAARAAALLERVAIRADEAMKWDVKPWRLDVLKTSSLANAALGETANADLIVVALRQTHSPPDELRGWLESWAMKRQTVDAAVMVLCPEENAASTPLWRELKEFAERHGLPFLGSRILRDDGDSMDFVHGLWQQKQPPQPVVPTLELLAGSSRPPRHWGINE