NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181351_1004286

Scaffold Ga0181351_1004286


Overview

Basic Information
Taxon OID3300022407 Open in IMG/M
Scaffold IDGa0181351_1004286 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)5301
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1881Long. (o)-86.344Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074796Metagenome / Metatranscriptome119Y
F077031Metagenome / Metatranscriptome117Y
F101034Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0181351_100428610F101034AGGMKLKYPTLDNIVPMLVAFVAASIVGMTFTNYVICNFKVMTSLHYLYLVKAFNQTGAKPPSKCDDNTSESVQTLMSLLATIIALKADLKRKPEDNKNE
Ga0181351_10042864F077031GAGMKEIPEFGFKIRITPKRSLIAILIASSLAFLTTKCGMSKQDVLKYYNELRKLIKWDLPDSIIDDIDNELNDKINNDPELLRQKIQTEVDGAIRNYELEEERNRVINMKNKNILEEINKDKYNKLQKLIVENAIYYEFADGTMGIRGAWVAPDPREILLE
Ga0181351_10042866F074796N/AMPENLPQEPEKIVDIASKAEYLKVDTNLGEVKLNSHNSVELQPDGTIFGTKIKVEENGNITPTLTLDTKKLRESKKNIDTKQLLDDAIDDFWEGQE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.