Scaffold Ga0224509_10407347

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224509_10407347

Scaffold Ga0224509_10407347

Overview

Basic Information
Taxon OID	3300022306 Open in IMG/M
Scaffold ID	Ga0224509_10407347 Open in IMG/M
Source Dataset Name	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	502
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	37.7	Long. (^o)	-122.34	Alt. (m)		Depth (m)	11
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096216	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0224509_104073471	F096216	N/A	MRIPKSLKEVLVKDYIQINKIRSTEYDNPFTRTIDLLCIFNDREAVLKCKPSELAIDLSHLLVEPSRVLKQYFTINGKRYGIVNHINDLEAGQYMSFTTYLKGFADNPNVHIEQMPDILASVIFPVDKNNKVMAIEPS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.