Scaffold Ga0224502_10263529

Overview

Basic Information

• Taxon OID: 3300022218
• Scaffold ID: Ga0224502_10263529
• Source Dataset Name: Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 664
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.03
  • Long. (^o): -122.37
  • Depth (m): 9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014973	Metagenome / Metatranscriptome	258	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0224502_102635292	F014973	AGGA	MRLKLKVDLGDGTEVRELTTNMFVICEWERTENRKTSDGKGIGYSDLVCWAYHLLKLQGEKMPATYRDWVKANPNMTIEAVDETDPNLT