Scaffold Ga0190313_1121321

Overview

Basic Information

• Taxon OID: 3300022188
• Scaffold ID: Ga0190313_1121321
• Source Dataset Name: Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-10-11_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 657
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: Mexico: Guaymas Basin
• Coordinates
  • Lat. (^o): 27.0114
  • Long. (^o): -110.5931
  • Depth (m): 1999

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094688	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0190313_11213211	F094688	N/A	RIYGRQKETAQYVRATHSGKSIIKEYSQIETLRVVEIHDELEPYRVTRLQGPWLQGHYELNAKVSDKFMFDPFENIYNSYYEISGGVSIYSSFVSLGDGHITYLISPNLPIIEVPTLYLAGSVSHAYVSGNNEDFYEVSFVPNHTGYIGSSEIDLRGLERFFLKLEGGSFSALHISCDLGSVYNPLPWAVPDGPTTYYYSKDKDIDVDLHVEYRAAYY