Scaffold Ga0196899_1038147

Overview

Basic Information

• Taxon OID: 3300022187
• Scaffold ID: Ga0196899_1038147
• Source Dataset Name: Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1642
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Delaware Bay
• Coordinates
  • Lat. (^o): 39.12
  • Long. (^o): -75.25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097245	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0196899_10381471	F097245	N/A	MKYKVFDTVDDAMAFTEDAGRRKGLAYHNGDPSGTRYLWG