NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196899_1002483

Scaffold Ga0196899_1002483


Overview

Basic Information
Taxon OID3300022187 Open in IMG/M
Scaffold IDGa0196899_1002483 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8641
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (31.82%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.12Long. (o)-75.25Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005382Metagenome / Metatranscriptome402Y
F036146Metagenome / Metatranscriptome170Y
F059774Metagenome / Metatranscriptome133N
F098941Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0196899_100248312F098941N/AMEGIVRGMRARACMPFRFKTMTTTAPKFYHWGEKLSAFTSDNRLVMSFGSPITHIPFNIAELQGFVCTLEQAIDDEPNAKQRIALGAIKIIFEASLKIAKRDHEEMVNNAPVGADLEEYMLNYANAVKNGEL
Ga0196899_100248313F059774GGAGMIYGEYENDPELDWERPNRLNRQLSLQQLESRLELWKQKHEDMCLKLYRAATGI
Ga0196899_100248321F005382GAGMDKTTLIKRFIFNAGSSIVSVQFIKADGSVRSLQFNPRDSREIKGTGTAIKKPSIVRCRDFRIARTAGEGAWRSFDCERVISVKANGQALSF
Ga0196899_10024839F036146AGGAGGMTPCRTWKITTSEGRTIALGAVSPKQAEHFLLAMRPDIKIALIEEIEPLPEPSPEQWP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.