Basic Information | |
---|---|
Taxon OID | 3300022181 Open in IMG/M |
Scaffold ID | Ga0228535_1074831 Open in IMG/M |
Source Dataset Name | Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 610 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New York | |||||||
Coordinates | Lat. (o) | 42.4447 | Long. (o) | -76.485 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072821 | Metagenome / Metatranscriptome | 121 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0228535_10748311 | F072821 | N/A | EIYLRAVEDHKCPHCGEKLNRRPRRLWQKAVSFAVPLRHYKCEGCYHRFFALSPRWKQMKKGERWLRVAATGVVWIAGIFIVFRILFSVLYAVMS |
⦗Top⦘ |