Scaffold Ga0181353_1080346

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181353_1080346

Scaffold Ga0181353_1080346

Overview

Basic Information
Taxon OID	3300022179 Open in IMG/M
Scaffold ID	Ga0181353_1080346 Open in IMG/M
Source Dataset Name	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	824
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	43.2382	Long. (^o)	-86.2805	Alt. (m)		Depth (m)	8
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062694	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181353_10803463	F062694	AGAAG	MKKFETWFLKYGHWSFLTSSLFEASESRWLTAAAFMFLFINYQFLNKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.