Scaffold Ga0228536_1001025

Overview

Basic Information

• Taxon OID: 3300022177
• Scaffold ID: Ga0228536_1001025
• Source Dataset Name: Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 34066
• Total Scaffold Genes: 39
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 36 (92.31%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 42.4447
  • Long. (^o): -76.485

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103105	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228536_10010259	F103105	AGGAGG	VIPAPYNSWPVVMSTNKAAQLLGVDRKTLAKNKNMLARCSETIGGKSKVIRDRLLRELKI