Scaffold Ga0213932_1001492

Overview

Basic Information

• Taxon OID: 3300022166
• Scaffold ID: Ga0213932_1001492
• Source Dataset Name: Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3685
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.9255
  • Long. (^o): -83.5226
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085004	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213932_10014922	F085004	AGGAGG	MGLKNMSLLASATVAASGGSALVFADDGVTIQNGLHLIIPADADYQTRRNVTVKYRPPTLDSKTGAYGKDKKSICLAKPVVLTDGRVVFNTIRIEREMHPSVAAADAVELNKLGAQLLVDTDVDAFWATGSLT