NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224902_100041

Scaffold Ga0224902_100041


Overview

Basic Information
Taxon OID3300022066 Open in IMG/M
Scaffold IDGa0224902_100041 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5651
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (58.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014085Metagenome / Metatranscriptome266Y
F023355Metagenome / Metatranscriptome210Y
F025614Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0224902_10004113F023355N/AMALPGAYVVNSPKLGQYCSNCLHYSNNYCLKFAKEVASYGWCAVWEPIKNEV
Ga0224902_1000415F025614GGAGLSGNKPFDVSRVNIFTHPKYMKVWAQQFNKACGSDTFKVQPDMEKLRFLMDKFVTDYNYHLEQLEGEEE
Ga0224902_1000417F014085N/AMNGLSEIREEAMQRANGQCEWAYCNDSKWLELAHIQGIGMGGNKKRKFDINNVAILCKHHHDIYDGRQRVGTSVAYRDLLKGFLKREQTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.