Scaffold Ga0222712_10016313

Overview

Basic Information

• Taxon OID: 3300021963
• Scaffold ID: Ga0222712_10016313
• Source Dataset Name: Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6378
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (38.46%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.1516
  • Long. (^o): -121.6883
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012871	Metagenome / Metatranscriptome	276	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0222712_1001631310	F012871	AGG	MYGIALPEAQLLQMLHEFIGKHFRWVTFEHFNLAFELNAANELSKKCEHFGALSVSFIGDVLTHYKPHRDKANLQIQREIAQSIEEKAELIKENEMAVNDDSWRRMLKEDIESFKQGKMTTLELRGVSMMRWLEESKRITLETFTEEEYQRCKAKARKTVFNEQQLSKGMVERMSDRKRQLLKESIQFEGLRELYKLYLSKQ