NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222712_10006849

Scaffold Ga0222712_10006849


Overview

Basic Information
Taxon OID3300021963 Open in IMG/M
Scaffold IDGa0222712_10006849 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_657D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11173
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (90.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.1516Long. (o)-121.6883Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000354Metagenome / Metatranscriptome1244Y
F005701Metagenome / Metatranscriptome392Y
F009599Metagenome / Metatranscriptome315Y

Sequences

Protein IDFamilyRBSSequence
Ga0222712_1000684913F005701AGGAGMFTNCIAYAKLVYNKKLKAYKVQIAFNVHKKLVGEEIKYVFPVQKQCNYVSGDLLADNLQNEVERTVASAQQHLRTTNIVFVD
Ga0222712_100068494F009599AGGAGGMIRLEGLSKQDIQICNLLWNCDSLEDVERMVNAMPPAYKQRAQVMRELMTAAQLDQVEIVDEAVTQYLHSIASR
Ga0222712_100068496F000354GGAGMAKVNYDAFQSFDINEACDHFDSMDQRAWKKIGKFIVADGQEYVDVMENHFDFEDTADGEYAAFDAGVKYALTKMNLALEAAGIDIEIKEVDLVESMGFMLVRTDDDPESFVKRALKKPVLMVESWVD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.