Scaffold Ga0222712_10000976

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0222712_10000976

Scaffold Ga0222712_10000976

Overview

Basic Information
Taxon OID	3300021963 Open in IMG/M
Scaffold ID	Ga0222712_10000976 Open in IMG/M
Source Dataset Name	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	36461
Total Scaffold Genes	57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	53 (92.98%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	38.1516	Long. (^o)	-121.6883	Alt. (m)		Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100732	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0222712_1000097647	F100732	GAG	MPVSLKKRDKYEEVYRKRLATNKAAFDQMTEEQQKVVRDTQVALRSFVSDFSDSFDVTTSTARELQDCFWRMNNAFRTEEDSE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.