Scaffold Ga0222716_10022301

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0222716_10022301

Scaffold Ga0222716_10022301

Overview

Basic Information
Taxon OID	3300021959 Open in IMG/M
Scaffold ID	Ga0222716_10022301 Open in IMG/M
Source Dataset Name	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4693
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	38.0283	Long. (^o)	-122.37	Alt. (m)		Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053968	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222716_100223015	F053968	AGGAG	MAVVSNPNSAVVAKSGLGPTTYIYAVATGTITVAAACDSITTTYGGTIAAVEGVADGNHVAVQGGPGGAEAVSGITLVATFAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.