NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222718_10012019

Scaffold Ga0222718_10012019


Overview

Basic Information
Taxon OID3300021958 Open in IMG/M
Scaffold IDGa0222718_10012019 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_27D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6357
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.6183Long. (o)-122.2916Alt. (m)Depth (m)12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020895Metagenome / Metatranscriptome221N
F038472Metagenome / Metatranscriptome166N
F046082Metagenome / Metatranscriptome152N

Sequences

Protein IDFamilyRBSSequence
Ga0222718_1001201910F038472AGGAGMRYEMKNFIKITKKPSNVGQSDKPKRDDWKRERKIARQNKINLRKSVA
Ga0222718_100120195F046082AGGAGMEAIIKLTERMLSKSEINANKTVRQFLSEEYDMEYTNPFFKENKFTVTGEYIDGTEAKVNFFTRSGRGDKMVSIQKLKQYANAGDEVHLSTQWDENETRIFILISIHKTSTDAA
Ga0222718_100120196F020895AGGAGVTIRAYEIVLEIDGQDSTITLDDTFPAIVDWHTACTMAVLMAKHVHPECEIEFISCTEYDAEEYDDYGYIFPAPMQLH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.