Scaffold Ga0063755_1119323

Overview

Basic Information

• Taxon OID: 3300021954
• Scaffold ID: Ga0063755_1119323
• Source Dataset Name: Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 534
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Norwegian Sea, Atlantic Ocean
• Coordinates
  • Lat. (^o): 71.2008
  • Long. (^o): 8.8666

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010751	Metatranscriptome	299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063755_11193231	F010751	N/A	KPQAAAMKASSQLLLLLLTPVMGSKRLEAVRKMVSARHLSVAGLPDPMCKTGVISLKVAGQAQVCCAGYCGECSDYSTCGSVREQNSTFACCATPVFERRCGNSPANVCLKSCKDSVPPCIMEENEVFTTPDPATRTAGTDCDEAVADWRTRAANAMSTTPFPPTPAPPSR