Scaffold Ga0063754_1009336

Overview

Basic Information

• Taxon OID: 3300021937
• Scaffold ID: Ga0063754_1009336
• Source Dataset Name: Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 911
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): 78.8697
  • Long. (^o): 8.1122

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020015	Metagenome / Metatranscriptome	226	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0063754_10093361	F020015	N/A	VTKPPAFNFNRFISNAWFYSGRSSDGNEEGFLEKLARRHHYKLQIHHLETFKDNEFRAALFSENIHCIVFPPLTHFPGISELAKKDLRGYVSAGNNVVFVGSYEWLSVMNDVFGFQLMSDYKDGPYYRNDRTVKGTPFQWSMSRLEQPDGAIYSVKVDSIPMDGSCMFDTMGACVVFYVKYNLGTVVYIAFDYDTPYGIGHWGQILHAGMMM