Scaffold Ga0063135_1122448

Overview

Basic Information

• Taxon OID: 3300021908
• Scaffold ID: Ga0063135_1122448
• Source Dataset Name: Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 760
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 40.529594
  • Long. (^o): -13.190131

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027855	Metagenome / Metatranscriptome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063135_11224482	F027855	AGGAG	MGYADYSTTKANERPPYKSTVQLEESESESDSDSDDDVNAQVEADKVIEKHPIYNAWESVKDGAADGKYERAITPNFSGDSDDIFMRSMLKKYAFEKRTAREELDDGSIIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLSTYMETYFDKAWENFDVNGDGAVEVIK