Basic Information | |
---|---|
Taxon OID | 3300021907 Open in IMG/M |
Scaffold ID | Ga0214480_102760 Open in IMG/M |
Source Dataset Name | Marine eukaryotic communities from Monterey Bay, California, United States - M1_20Mar14CPVII9sort6BwellE17 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4592 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Seawater → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 36.746 | Long. (o) | -122.0257 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100378 | Metagenome / Metatranscriptome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0214480_1027605 | F100378 | N/A | NSTMSDAYAIVDIPKSLPIHGMALTSTGRKIEHNKVVVGTQTSESLSWISLEKSGFSRLRGVAVLL |
⦗Top⦘ |