Basic Information | |
---|---|
Taxon OID | 3300021901 Open in IMG/M |
Scaffold ID | Ga0063119_1021758 Open in IMG/M |
Source Dataset Name | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-12 (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 874 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Chrysophyceae → Chromulinales → Chromulinaceae → Spumella → Spumella elongata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Ocean | |||||||
Coordinates | Lat. (o) | -4.668 | Long. (o) | -7.06118 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039428 | Metatranscriptome | 163 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063119_10217581 | F039428 | N/A | MVTGTASAGRHFRELAPKEGGSLVKPLKFNQKLLLCNAYSAKSPIAVSKNAQAVIPGGLGFQQCEYVPTDVLAKDKLDFAMTDAGIEGTFEVGELPQSDSVLLLVIQKRDSHSPLMAFQSFAFPMNSGKSEAHVAVIDASPSEAKAHLKISDRPLRAGDKSTTEELSFNRIYALEQGKYDVSVLAKGKQEQAEEVDLLGQKDYVLLRTGGEEQGAHTLVAFPRDEIQQSGATKPVGAMLVALSVIALSIFA |
⦗Top⦘ |