Scaffold Ga0063142_1039066

Overview

Basic Information

• Taxon OID: 3300021893
• Scaffold ID: Ga0063142_1039066
• Source Dataset Name: Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 647
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas commoda (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 54.633279
  • Long. (^o): -16.508962

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003454	Metatranscriptome	485	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063142_10390661	F003454	GGTGG	MWPPTWQDGFGRPIEELTNDSVFSLPVVRDPNSGRKVVNIKSWLTDQAYTGGIGDQFKGKGPVTNDNNKKLPKFDRCKGDCVKVRNPWAAPGQAPVLGGGCGVFGGNPLGCPAGKDTRPVGSQCGQDKPIGRGKRGTSSFGTDARLFDFPEMITTEWQVGSTQDVVWTSSGAHRGGYTYRLCKMPSGGR