Scaffold Ga0063090_1013567

Overview

Basic Information

• Taxon OID: 3300021890
• Scaffold ID: Ga0063090_1013567
• Source Dataset Name: Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 940
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis aeruginosa (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates
  • Lat. (^o): 73.0188
  • Long. (^o): 9.8566

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016768	Metatranscriptome	244	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0063090_10135671	F016768	N/A	SSDAGCCVGGPETSCGGVGNACFEGAGNMLTTADWSYAVPQKQTFVTPYGCRIRPCCLLLALLSLLGMALAYFLRPKSLAQLAPLPAPVGPVGTCTLWGDPHIRTFDGIRSDYYSPGEFWIVKSDNVWIQGRYLPTKVTSGLGVTKSIAVGGPFLKGHKLRVEVRSASWDGQPVLTGFPSDFSVPGVIDMHYNNVGTLLQNGREGKALHIVHIRLEDGSPEGLQIQVNRWMEPTEGDYMNVKITMHGQKGQDGHCGNFNANPQDDDRLQVRARVGKTGVDPKDSMYATKTPVMVANRPNINDCPAQKLEDAKT