Scaffold Ga0063132_101770

Overview

Basic Information

• Taxon OID: 3300021872
• Scaffold ID: Ga0063132_101770
• Source Dataset Name: Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 614
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 34.719778
  • Long. (^o): -14.259726

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005084	Metatranscriptome	412	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063132_1017701	F005084	N/A	LLLLDSLLQESISSTMTTLCSTPSLFKVFESFSIFTCLVIHRIGNQGSQIWFGTSDYEMSYKATKSEVDAEIIGCGILTCMAIVTLTILLSYLVEGREVVQSTILDTVFSFVAACLLVTAGAMCCFTYNSVFALSGPATIANQNISRSSLGVAAAMGVMCIFSGLIYLADFFFCLTQRRKFLDDRGY