Basic Information | |
---|---|
Taxon OID | 3300021864 Open in IMG/M |
Scaffold ID | Ga0063141_100961 Open in IMG/M |
Source Dataset Name | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S21 C1 B12 (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 525 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 52.621788 | Long. (o) | -16.497225 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039443 | Metatranscriptome | 163 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063141_1009611 | F039443 | N/A | LILSLAVAAQAAPQLLYGGVGIHAIPTVVKQEVKYKTAAFEPVEADTPADATLIELKETEHKFDTLVPGPVQYAHTGFPLGYGYGYGLPLAAAPVKVEVPEVKTIELPATPYLGYPYGLGLGYPYGLPVVAAAPAAEEPAAE |
⦗Top⦘ |