Scaffold Ga0213853_11020535

Overview

Basic Information

• Taxon OID: 3300021861
• Scaffold ID: Ga0213853_11020535
• Source Dataset Name: Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 529
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 41.1752
  • Long. (^o): -78.4168

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047877	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213853_110205351	F047877	AGGAG	VTDTTELRTALAGLLSFAAAEEQALLAAASFCPDYDRGSPDRWAAVPLVAHNNQFKGQQAERISAIRSGQVPAAYGEVDHSSAEVYQGYSAQPPDAVLTECRRVSAELVDGTCALPDEDLLDPGRHPWLNGRMLWLQI