Basic Information | |
---|---|
Taxon OID | 3300021853 Open in IMG/M |
Scaffold ID | Ga0210323_1011029 Open in IMG/M |
Source Dataset Name | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.189 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 728 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Peloderinae → Caenorhabditis → Caenorhabditis elegans | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oregon | |||||||
Coordinates | Lat. (o) | 46.187 | Long. (o) | -123.687 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001291 | Metagenome / Metatranscriptome | 729 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210323_10110291 | F001291 | N/A | LRSNLNXIQVLLLFKSKRKMSALLFILASVVASTLAAPTPACVPDKTQFYWKVPCDGQTFTDRIQVNSIDASQGGKSVDQQGGFDISQNIDLKVGIVDQYGTVNKPLVDVAILEYSKGLSGKCEWKNVPTLGLLDNIDGCKILQNCHLTGTPTTLDASISIKDLAGPLYSGISTDTYYGLQMTFKDDKTPFLCVYSQDIVIKK |
⦗Top⦘ |