Scaffold Ga0226832_10174081

Overview

Basic Information

• Taxon OID: 3300021791
• Scaffold ID: Ga0226832_10174081
• Source Dataset Name: Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 829
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location

• Location Name: Daikoku vent field, Mariana back arc basin
• Coordinates
  • Lat. (^o): 21.3250983
  • Long. (^o): 144.19162955
  • Depth (m): 409.13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083255	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0226832_101740813	F083255	AGGA	MKPFRFHSLTDNTDRYLQGSNNFPYGAPKPSLADDDLPYGDEPAKACAEEDGVKCFSCKGYFPASSCVINHGDYGEEVPVCETCAEGRFCPKPDGNNTDPWEYGEQP