Scaffold Ga0194061_1185295

Overview

Basic Information

• Taxon OID: 3300021601
• Scaffold ID: Ga0194061_1185295
• Source Dataset Name: Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 608
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Ontario
• Coordinates
  • Lat. (^o): 49.69
  • Long. (^o): -93.718

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096879	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194061_11852952	F096879	AGGAG	MTEADKKYMERKTQKDWEYDEFEDSDYAQFVQQVKGLVAWVIIMVGVSMIIAAVFK