Scaffold Ga0224717_1148545

Overview

Basic Information

• Taxon OID: 3300021556
• Scaffold ID: Ga0224717_1148545
• Source Dataset Name: Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st36ic 200bp no Eukaryotes last
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 628
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'control' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.828217
  • Long. (^o): 150.820517

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039181	Metagenome	164	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0224717_11485452	F039181	AGGAGG	MPKGKYYEYQIKRSALDQDYLSGNIDDFQYARESLDLDLKYEPYILAQTINSEVAKKQHENNNEA