Basic Information | |
---|---|
Taxon OID | 3300021552 Open in IMG/M |
Scaffold ID | Ga0224709_1095408 Open in IMG/M |
Source Dataset Name | Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co15aic 200bp no Eukaryotes last |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 678 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Upa-Upasina CO2 seeps 'control' site, Papua New Guinea | |||||||
Coordinates | Lat. (o) | -9.828217 | Long. (o) | 150.820517 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013419 | Metagenome | 271 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0224709_10954082 | F013419 | N/A | MRESKYSFLYRNSDGHVMRPESFLNINKGRTLSSSQLRMLGIEKIKNPSYKRQATSIKRQAAST |
⦗Top⦘ |