Basic Information | |
---|---|
Taxon OID | 3300021540 Open in IMG/M |
Scaffold ID | Ga0214517_102360 Open in IMG/M |
Source Dataset Name | Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Xylan, Gen4, Rep 3, Penicillin and Streptomycin |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2855 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (37.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Herelleviridae → unclassified Herelleviridae → Herelleviridae sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.4149 | Long. (o) | -119.841 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097585 | Metagenome / Metatranscriptome | 104 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0214517_1023603 | F097585 | GGA | MEISIDENKPHKVSEVICVKCLHRWIAVRPIECRLKDLECAGCGEQGYVIETGEVIDG |
⦗Top⦘ |