NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194048_10044462

Scaffold Ga0194048_10044462


Overview

Basic Information
Taxon OID3300021519 Open in IMG/M
Scaffold IDGa0194048_10044462 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1814
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.697Long. (o)-93.722Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023107Metagenome / Metatranscriptome211Y
F066766Metagenome / Metatranscriptome126N
F091353Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0194048_100444621F091353GGAMIKTAVDLFDEVCNGIAKGELDKQLVPLKKLIEERLSVVRVDADIKDFVVGDRIVLNSNCGTKSLIGDEGTVVAIRRSKITITFDKPKGRFARTNSQGEIYSANAVVPISIVDKI
Ga0194048_100444623F023107AGGMDNILPSRTVMFVGDYFTLMTTIVLDEKLRNEGEADNDFAVRVASVFMSEFYGFDVASVANSIGVVDEDGIEV
Ga0194048_100444624F066766AGGAGMAIKEVELEYTVDTLAKLVRDNYGKNAVEYLVGRLTSVVSESQLKALIDYEKGVNG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.