Basic Information | |
---|---|
Taxon OID | 3300021508 Open in IMG/M |
Scaffold ID | Ga0190283_1059048 Open in IMG/M |
Source Dataset Name | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-0-1_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 722 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico: Guaymas Basin | |||||||
Coordinates | Lat. (o) | 27.0074 | Long. (o) | -110.591 | Alt. (m) | Depth (m) | 2001 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F076639 | Metagenome | 118 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0190283_10590482 | F076639 | N/A | MKKTESQSEPERAPICWMHEAIAYLGLDRLGLARPDLAVHRLIRKGALHPRKIGGHLAFDKSELERVAANGDQKRGRGRPRKLP |
⦗Top⦘ |