Scaffold Ga0190358_1123365

Overview

Basic Information

• Taxon OID: 3300021506
• Scaffold ID: Ga0190358_1123365
• Source Dataset Name: Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-1-2_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: Mexico: Guaymas Basin
• Coordinates
  • Lat. (^o): 27.0114
  • Long. (^o): -110.5956
  • Depth (m): 2011

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056630	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190358_11233651	F056630	N/A	IKGEKSGDVVTIKDTDDKWINFNEGGRLAKDLQDEFIQLLDEDIAGEFVNPTSTETDPLNVSAAQKLPTEVSIPALDATPNPIRVLFDKQKKNNKVKLLLEFPVNIPQKAVYELMSTSFDRNEVNDVLQSFINDQLSEDEILDCLYNSIQSLIESKYKGE