NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182009_10390443

Scaffold Ga0182009_10390443


Overview

Basic Information
Taxon OID3300021445 Open in IMG/M
Scaffold IDGa0182009_10390443 Open in IMG/M
Source Dataset NameBulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)717
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa

Source Dataset Sampling Location
Location NameUSA: Nebraska
CoordinatesLat. (o)41.1613Long. (o)-96.6752Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030216Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0182009_103904432F030216N/APTGRVGHPCSMQGSVSLEQRLEGHVPSPSGRRVTRSSFRRPGGGLRRRIDASLDEAVQIFELDRLLYDIEVDAQHAWLRRLMAFDAYCARRDAGGAPDRPVR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.