Scaffold Ga0213878_10227188

Overview

Basic Information

• Taxon OID: 3300021444
• Scaffold ID: Ga0213878_10227188
• Source Dataset Name: Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 789
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location

• Location Name: Brazil: Minas Gerais
• Coordinates
  • Lat. (^o): -19.28
  • Long. (^o): -43.5919

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002177	Metagenome / Metatranscriptome	587	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213878_102271881	F002177	N/A	QPPTRGRQIKFTPERIQQVRNLVERGKSREEIAELIGVTAGSLQVTCSRLGISLRRVVFNNGMGLLRRGEPHNGTSTYTASRSGGFSLPPISGQPQQNSESGPLGQPQATTPHEERARTDEMGLANLALRMTYRDYERTSELPLTQDMIRQLAFEAQFRNMSIGELVGEFLIAMMKRDFFEHVLEPNSKQP