Scaffold Ga0213879_10066767

Overview

Basic Information

• Taxon OID: 3300021439
• Scaffold ID: Ga0213879_10066767
• Source Dataset Name: Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 973
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location

• Location Name: Brazil: Minas Gerais
• Coordinates
  • Lat. (^o): -19.28
  • Long. (^o): -43.5919

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071626	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213879_100667672	F071626	GAGG	MEIRNQSKTGPTVPPLAEITATLSRQIEDLKQPWLDRLNQDPASFAHLEREIHDCFRHLADQLTASLLASTTPLSQRAEPEKKGGPAATPCDAPRKRGG