NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213920_1032139

Scaffold Ga0213920_1032139


Overview

Basic Information
Taxon OID3300021438 Open in IMG/M
Scaffold IDGa0213920_1032139 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1184
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9255Long. (o)-83.5226Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001059Metagenome / Metatranscriptome790Y
F006264Metagenome / Metatranscriptome377Y
F027490Metagenome / Metatranscriptome194Y

Sequences

Protein IDFamilyRBSSequence
Ga0213920_10321391F006264N/AMEDPTKIFQNRLSSQAEACARKTLEWLQKDLQGTHKLEPDEVYYLAYAAQIL
Ga0213920_10321392F001059AGGAMATYDIDALKVDLPSAKELAQFVYDKTDGLVSLDLIGKPKEEQYIVAKNALEGKKVPAEYLTGFNPYVEKKDVIPEDPLRKLPKRSIDLPDEESQVHYFGATNMPHPLDPQSDKKVYIDFRKYENGLITYQITGPVEKIPVGEKLNKYGQTVPEKYSWIDPRTEEKVMRNPDGTFTKEGRGIHTFLIGEKGGGIWSLIDRDIVSISAKNIADPWA
Ga0213920_10321394F027490N/AGGAPMRKGMTKGINDKLASRSAEDSRRATVAGAVNSAYKVDTVSSQHTNNSNKGQFTKPSNRSKNYAGV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.