Scaffold Ga0213920_1014207

Overview

Basic Information

• Taxon OID: 3300021438
• Scaffold ID: Ga0213920_1014207
• Source Dataset Name: Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2170
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.9255
  • Long. (^o): -83.5226
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066584	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213920_10142072	F066584	N/A	MKHDKYTQNGIEGPFTPPPTLADKVLFWLSGFVAGLVFTLLITGN