Scaffold Ga0213917_1043790

Overview

Basic Information

• Taxon OID: 3300021437
• Scaffold ID: Ga0213917_1043790
• Source Dataset Name: Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.9406
  • Long. (^o): -83.5607
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089963	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0213917_10437901	F089963	N/A	DALTPGRWHAVNRRIWGGYMRLGRRDLVGFELEAALRPLFRALHLRDLDLGLERKTRELLARTIERIADVAGETIDRLLEAGDRNAAMQRWQDVRGIIQKARDQGLSHEELAHSFGRARRMLEQIEATKG