Scaffold Ga0224423_10525639

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224423_10525639

Scaffold Ga0224423_10525639

Overview

Basic Information
Taxon OID	3300021431 Open in IMG/M
Scaffold ID	Ga0224423_10525639 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from New Zealand - Tag 1435 SPADES assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1039
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location
Location Name	New Zealand
Coordinates	Lat. (^o)	-42.26	Long. (^o)	171.6	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009724	Metagenome / Metatranscriptome	314	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224423_105256391	F009724	N/A	AKENVTNEDNVKEWMKDYLKKKKFTMPNDGAYIVLQPAVADSRERPYKVKKPKYDARTHSPEKFYILRDKTGNEIGRAKTSKEAEQIAKEFVTDFKESISINIEWVSKEKNSLYAIVDYTPSKGSQPCKLLVFGYPVID

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.