Scaffold Ga0224423_10035239

Overview

Basic Information

• Taxon OID: 3300021431
• Scaffold ID: Ga0224423_10035239
• Source Dataset Name: Sheep rumen microbial communities from New Zealand - Tag 1435 SPADES assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 4976
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location

• Location Name: New Zealand
• Coordinates
  • Lat. (^o): -42.26
  • Long. (^o): 171.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072829	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224423_1003523912	F072829	AGGAGG	MSKHTIYDDMIDEYFNRHPDAGLAWWMLPLEQQPEGFKLEMYDILWSLLNKT